PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn333991
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 746aa    MW: 82685.3 Da    PI: 4.8715
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn333991genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.11.5e-11494537146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r rW++++ el+++av+q+G++  + I + ++ gRt+ q+k+++ k
       Achn333991 494 RSRWSKQDTELFYEAVRQFGSD-ISMIQQLFP-GRTRTQIKLKYKK 537
                      78********************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159631.7E-27487570No hitNo description
SuperFamilySSF466893.95E-10489539IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-7491537IPR009057Homeodomain-like
PROSITE profilePS512939.857492540IPR017884SANT domain
SMARTSM007172.9E-9493541IPR001005SANT/Myb domain
CDDcd001672.07E-7496537No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 746 aa     Download sequence    Send to blast
MGTDLDPLDE IFSECAANNA RAGGKFRPKA KPRCRKESSA PSPSISVQAV GIAENKLSSL  60
GGPSLASSET LEAKTSLVNN GELISGVHSS DDSALVNLSL EHHVIGETLG CNVGPHSDVI  120
TDTNGDLHST TGKSAGQGED LFFGLESLYE FYSQTPMVTS ESTYPENVDP GVELANEFAA  180
SCPANKHVED SLACSEIPTV DVSDTKNSEE GPFIPVVSPL DDSAVRVSNT SSSYACPEVS  240
NVQDPLTCEE ACASSSDGGF LVTNRRLEIE VSPSAKNRKR KPPMVSDDSV EHQKASTSGQ  300
ENEAGRSKRQ LRERTNTCSL VDEVHEGGNF TNRCSAGSLI DEYDNDCDEY QVPSESRNRK  360
EPRKSNKSAP QKEKPVRKRK KSNEVPDHAS KEPVKKFSHS TRRKRRQAFD KVLLEANWDD  420
IVRQKLPIRD IILLAEYKER MPSKEGKTSE VPLANQSAGN PSEQGGSNKD QTNPMVEESF  480
TYTNYQSYMN KTPRSRWSKQ DTELFYEAVR QFGSDISMIQ QLFPGRTRTQ IKLKYKKEER  540
QHPLRLHEAL TTRAKDHSHF QRVIDHLQQV AAQEKQNSCR DDSIELTGDE EDLDPEINEE  600
VTKSEQAEEG EVESVEPDVT EVQSPVKMYQ FGKRGLHILT FPTINNEAGE GEIENLNSLR  660
QFIWRSSQLV PTNLNLWHHL KQKFTEEEKG KGIAKPMDME TSKDQLESSS LDLLSALNPI  720
DATLSMNDFH VDWESGLSAS STVDV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1373379KPVRKRK
2376380RKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA59022326
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.17e-48MYB_related family protein